PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI10G15680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 406aa    MW: 44007 Da    PI: 9.9779
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI10G15680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14e-13351148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd+l+++  +++G g +W + +  +g+ R++ +c+srw++yl
  ORUFI10G15680.1  3 KGKWSKEEDDLIKNHMEKYGIGrSWQALSDALGLQRCGRSCRSRWLNYL 51
                     79******************999************************97 PP

2Myb_DNA-binding322.9e-1058101247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g +++ E+ ++ +   + G+  W++Ia+ ++ gRt+  +k++w++ 
  ORUFI10G15680.1  58 GDFSPAEERIICKMYSKKGSS-WSAIAAQLP-GRTDLAVKNYWNST 101
                      679****************99.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.125155IPR017930Myb domain
SMARTSM007172.4E-10253IPR001005SANT/Myb domain
SuperFamilySSF466892.42E-24298IPR009057Homeodomain-like
PfamPF002499.9E-12351IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-19458IPR009057Homeodomain-like
CDDcd001672.14E-8551No hitNo description
PROSITE profilePS5129414.57856106IPR017930Myb domain
SMARTSM007176.4E-1156104IPR001005SANT/Myb domain
PfamPF002492.0E-958101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2059105IPR009057Homeodomain-like
CDDcd001674.18E-760102No hitNo description
SuperFamilySSF1014479.94E-6201211No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MKKGKWSKEE DDLIKNHMEK YGIGRSWQAL SDALGLQRCG RSCRSRWLNY LRPGLKHGDF  60
SPAEERIICK MYSKKGSSWS AIAAQLPGRT DLAVKNYWNS TLKKRFPAAA AARSTAAARR  120
RHRPAASATT SSDDDDDVDV DDATPPGLAL VVYSEGSTAA AAAAGELAPY SISSPAATAD  180
AAEEEEPIAA VPISTCILAL PPPPPPPPPP PSDATGGEGS IPCFPFGLAG ADLDDRPRRH  240
YRHLRCRRLP LPEAAASNHT GFASPSEASR HCRLRRRAEL LVLFLSICLR YNTSPFLLAR  300
ATAAPPAAAA DRCLAGRRCL YSTTPPPPLS PLHWRCSRRD PELGADVSAL LLRGRLGARQ  360
LFDELPHRVR WRRGYLRAAF AASVSNLNAR DGHRGVKAEA MKSSAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-24110525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0798880.0AC079888.10 Oryza sativa chromosome 10 BAC OSJNBa0078O01 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0R0Z90.0A0A0E0R0Z9_ORYRU; Uncharacterized protein
STRINGBGIOSGA031610-PA1e-157(Oryza sativa Indica Group)
STRINGLOC_Os10g35660.11e-157(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-40myb domain protein 36